DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxa6

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_034584.1 Gene:Hoxa6 / 15403 MGIID:96178 Length:232 Species:Mus musculus


Alignment Length:133 Identity:72/133 - (54%)
Similarity:91/133 - (68%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 SGSGVSGGPGNVNVPMH-SPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTV 318
            ||:....|||:.   :| ||   :...:.|...:..:....|..:|....:||||:|::.....|
Mouse    91 SGNNKQRGPGDY---LHFSP---EQQYKPDGSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGAV 149

  Fly   319 -NANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 382
             .::|  :|.|.:||||||||||||||||||||||||||||:|||||||||||||||||||||||
Mouse   150 YGSHG--RRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 212

  Fly   383 HKM 385
            :|:
Mouse   213 NKL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 49/52 (94%)
Hoxa6NP_034584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..126 9/40 (23%)
Antp-type hexapeptide 135..140 3/4 (75%)
Homeobox 158..210 CDD:278475 48/51 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.