DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxa5

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_034583.1 Gene:Hoxa5 / 15402 MGIID:96177 Length:270 Species:Mus musculus


Alignment Length:234 Identity:99/234 - (42%)
Similarity:128/234 - (54%) Gaps:33/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 YANDPVTPGGSGGGGV-SGSNNNNNSANSNNNNSQSLASPQDLSTRDISPKLSPSSVVESVARSL 232
            |....::.|.||.|.. ||....:.:|.::...::...|....||....|...|.|         
Mouse    49 YNGMDLSVGRSGSGHFGSGERARSYAAGASAAPAEPRYSQPATSTHSPPPDPLPCS--------- 104

  Fly   233 NKGVLGGSLAAAAAAAGLNNNHSG-------SGVSGGPGNVNVPMHSPGGGDSDSESD---SGNE 287
                      |.|.:.|.:::|.|       ||.|...|:.::......|..|.:|.|   |..:
Mouse   105 ----------AVAPSPGSDSHHGGKNSLGNSSGASANAGSTHISSREGVGTASAAEEDAPASSEQ 159

  Fly   288 AGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANG-ETKRQRTSYTRYQTLELEKEFHFNRYLTR 351
            ||:...........|||||||:::|:  |..|..| |.||.||:|||||||||||||||||||||
Mouse   160 AGAQSEPSPAPPAQPQIYPWMRKLHI--SHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTR 222

  Fly   352 RRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNI 390
            ||||||||||||:|||||||||||||||||::|:.||::
Mouse   223 RRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSM 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 50/52 (96%)
Hoxa5NP_034583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 23/118 (19%)
Antp-type hexapeptide 176..181 4/4 (100%)
Homeobox 199..252 CDD:333795 50/52 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5833
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm42886
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4748
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.