DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Gsx1

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_032204.1 Gene:Gsx1 / 14842 MGIID:95842 Length:261 Species:Mus musculus


Alignment Length:169 Identity:60/169 - (35%)
Similarity:76/169 - (44%) Gaps:53/169 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 SLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSG 295
            |::.||..|..|||||||....::              |:..|......|...|.|:..||    
Mouse   100 SVSPGVAHGPAAAAAAAALYQTSY--------------PLPDPRQFHCISVDSSSNQLPSS---- 146

  Fly   296 NGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHA 360
                                         ||.||::|..|.||||:||..|.||:|.||||||..
Mouse   147 -----------------------------KRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATY 182

  Fly   361 LCLTERQIKIWFQNRRMKWKKEHKMASMNIVPYHMGPYG 399
            |.|:|:|:||||||||:|.|||.|.::      |.|..|
Mouse   183 LNLSEKQVKIWFQNRRVKHKKEGKGSN------HRGGAG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 33/52 (63%)
Gsx1NP_032204.1 SNAG domain. /evidence=ECO:0000250 1..20
Homeobox 150..203 CDD:395001 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..261 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.