DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Gbx2

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_446160.1 Gene:Gbx2 / 114500 RGDID:621866 Length:348 Species:Rattus norvegicus


Alignment Length:385 Identity:103/385 - (26%)
Similarity:144/385 - (37%) Gaps:112/385 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GSAGAATPGANDY--FPAAAAYTPNLYPNTPQAHYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQ 125
            ||....:||...|  :|....|.|.:.|..|..             |..:....|||   .|...
  Rat    29 GSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPPP-------------PPALPQAALQP---ALPPA 77

  Fly   126 QQQQQ-------------QQHAHAAAAVAAQQQQQLAQQQHPQQQQQQQQANISCKYANDPVTPG 177
            ....|             |..|..:..:|.......|..||       |:|..:.|:|..|: ||
  Rat    78 HPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQH-------QEAAAARKFAPQPL-PG 134

  Fly   178 GSGGGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLG--GS 240
            |                 .|.:.|::|.:    .|.|                  .|..|.  ||
  Rat   135 G-----------------GNFDKSEALQA----DTED------------------GKAFLAKEGS 160

  Fly   241 LAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGG--------GDSDSESDS---GNEAGSSQNS 294
            |.|.:||..:..:..|: |.|...:.:.....|.|        .|.|..||.   |..|...::.
  Rat   161 LLAFSAAEAVQASLVGA-VRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLPGQTAHKEEDP 224

  Fly   295 GNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAH 359
            |:..:..||     .....|::|  :.|:.:|:||::|..|.||||||||..:||:...|.:|||
  Rat   225 GHALEETPQ-----SGGAAGSTT--STGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAH 282

  Fly   360 ALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPYHMGPYGHPYHQ------FDIHPSQFA 413
            ||.|:|.|:||||||||.|||:. |..:.|      ...|.|...      ..:|.|:||
  Rat   283 ALKLSEVQVKIWFQNRRAKWKRV-KAGNAN------SKTGEPSRNPKIVVPIPVHVSRFA 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 33/52 (63%)
Gbx2NP_446160.1 Homeobox 250..304 CDD:395001 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.