DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxb2

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_598793.2 Gene:Hoxb2 / 103889 MGIID:96183 Length:354 Species:Mus musculus


Alignment Length:245 Identity:83/245 - (33%)
Similarity:108/245 - (44%) Gaps:72/245 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 GSSQNSGNGK--KNPPQI--------YPWMKRVHL-------------GTSTVNAN--------- 321
            ||.:.:|:|.  ::||.:        :||||....             ..|:|.|:         
Mouse    67 GSQKQAGDGPALRSPPPLPVAPPAPEFPWMKEKKSTKKPSQSAASPSPAASSVRASEVGSPSDGP 131

  Fly   322 -------GETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 379
                   ..::|.||:||..|.||||||||||:||.|.||:|||..|.|||||:|:|||||||| 
Mouse   132 GLPECGGSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMK- 195

  Fly   380 KKEHKMASMNIVPYHMGPYGHPYHQFDI-HPSQFAHLSAXD-AWHFSGTGXRLNQLYQEPYQTAA 442
               ||..:.:..|.. |..|.|..|.|. .|::...:|..| |.|      ||.:....|     
Mouse   196 ---HKRQTQHREPPE-GEPGGPSAQDDAGEPAEEPTVSPGDVATH------RLREACFHP----- 245

  Fly   443 AASAASGYQSQDGGPIGG------GSVGVGGGAGGPG-SLANGGSNGSGP 485
             |.||.|.:   |.|...      .||    ||..|| ::...|...|.|
Mouse   246 -AEAAQGPR---GAPPSALPATTLESV----GASSPGCTMLRAGGRQSEP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 38/52 (73%)
Hoxb2NP_598793.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..143 13/75 (17%)
Antp-type hexapeptide 92..97 2/4 (50%)
Homeobox 145..197 CDD:278475 38/55 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 13/42 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..295 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.