DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxa2

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_036713.2 Gene:Hoxa2 / 103690123 RGDID:2813 Length:372 Species:Rattus norvegicus


Alignment Length:148 Identity:58/148 - (39%)
Similarity:72/148 - (48%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 PGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNP-----PQIYPWMKRVHLGTSTV---- 318
            |....:|..:||.....| :.:|....||.....|...|     |..|||||.......|.    
  Rat    51 PFEQTIPSLNPGSHPRQS-AGAGGRPKSSPAGSRGSPVPARALQPPEYPWMKEKKAAKKTALPPA 114

  Fly   319 -------------------NANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLT 364
                               .:.|.::|.||:||..|.||||||||||:||.|.||:|||..|.||
  Rat   115 AASTGPACLGHKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLT 179

  Fly   365 ERQIKIWFQNRRMKWKKE 382
            |||:|:||||||||.|::
  Rat   180 ERQVKVWFQNRRMKHKRQ 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 38/52 (73%)
Hoxa2NP_036713.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..96 11/45 (24%)
Antp-type hexapeptide 96..101 3/4 (75%)
Homeobox 143..196 CDD:395001 38/52 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.