DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxa7

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001363856.1 Gene:hoxa7 / 101734257 XenbaseID:XB-GENE-483655 Length:207 Species:Xenopus tropicalis


Alignment Length:191 Identity:84/191 - (43%)
Similarity:100/191 - (52%) Gaps:44/191 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 VARSLNKGVLGGSL----AAAAAAAGLNNNHSGSGVSGGPGNVNVP--MHSPGGGD--------S 278
            |:...:|...|.||    .:...:...|:...|.|...||...:||  .:||...:        |
 Frog     7 VSALFSKYTAGASLFPNPESTPCSLASNSQRGGYGTGTGPFPSSVPSLYNSPLYQNPFPAYSLAS 71

  Fly   279 DS-----------------ESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKR 326
            ||                 |.....||...|.:.:..:    |||||:         ::..:.||
 Frog    72 DSYNLHCSSFDQNIPLLCNELPKAEEAALHQQADSHFR----IYPWMR---------SSGPDRKR 123

  Fly   327 QRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMAS 387
            .|.:||||||||||||||||||||||||||||||||||||||||||||||||||||||..|
 Frog   124 GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKEES 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 50/52 (96%)
hoxa7NP_001363856.1 Homeobox 125..178 CDD:365835 50/52 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.