DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxa4

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_077326.1 Gene:Hoxa4 / 100912525 RGDID:2814 Length:285 Species:Rattus norvegicus


Alignment Length:396 Identity:125/396 - (31%)
Similarity:146/396 - (36%) Gaps:175/396 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GGSGGGAGGSGGVVPSGGTNGGQGSAGAATPGANDYFPAAAAYTPNLYPNTPQAHYANQAA---- 100
            ||.|||.||.|            |..|...|.::.:.||.   .|:....|| |:||.:|.    
  Rat    27 GGPGGGDGGVG------------GGPGYPRPQSSPHLPAP---NPHAARQTP-AYYAPRAREPSY 75

  Fly   101 YGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAHAAA-------AVAAQQQQQLAQQQHPQQQQ 158
            :||           |.|                |.|||       |..|:.:|..|...||....
  Rat    76 HGG-----------LYP----------------APAAACPYACRGASPARPEQSPAPGAHPSPAP 113

  Fly   159 QQQQANISCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDISPKLSPSS 223
            |.......|  |..|.||..:.||...                   |.|  |...|..|      
  Rat   114 QPPAPPRRC--APGPTTPAVATGGSAP-------------------ACP--LLLADQGP------ 149

  Fly   224 VVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEA 288
                                                 .||                         
  Rat   150 -------------------------------------AGP------------------------- 152

  Fly   289 GSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNAN---GETKRQRTSYTRYQTLELEKEFHFNRYLT 350
                   .||:  |.:|||||::|:  |.||.:   ||.||.||:|||.|.||||||||||||||
  Rat   153 -------KGKE--PVVYPWMKKIHV--SAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLT 206

  Fly   351 RRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH-----KMASMNIVPYHMGPYG-------HPYH 403
            |||||||||.|||:|||:|||||||||||||:|     ||.|.|......||.|       ||:.
  Rat   207 RRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNPASAPAGPPGKAQTHSPHPHP 271

  Fly   404 QFDIHP 409
                ||
  Rat   272 ----HP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 46/52 (88%)
Hoxa4NP_077326.1 Homeobox 183..236 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.