DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxb8

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_002938067.1 Gene:hoxb8 / 100493882 XenbaseID:XB-GENE-990961 Length:243 Species:Xenopus tropicalis


Alignment Length:252 Identity:83/252 - (32%)
Similarity:100/252 - (39%) Gaps:116/252 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 QHPQQQQ--------------QQQQANISCK------YANDPVTPGGSGGGGVSGSNNNNNSANS 196
            |||.|.|              ||....::|.      |..||:                      
 Frog    49 QHPGQIQDFYHGTPSLSSPTYQQNPCAVTCHGDPGSFYGYDPL---------------------- 91

  Fly   197 NNNNSQSLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSG 261
               ..|||.|.||               .|.|..|..|          .|:|||           
 Frog    92 ---QRQSLFSSQD---------------TELVQYSECK----------LASAGL----------- 117

  Fly   262 GPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKR 326
                                   |.||.||:.|    .:|.|::|||:        ..|....:|
 Frog   118 -----------------------GEEAESSEQS----PSPTQLFPWMR--------PQAAAGRRR 147

  Fly   327 QRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH 383
            .|.:|:|||||||||||.||.||||:||||::|||.|||||:||||||||||||||:
 Frog   148 GRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKEN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 42/52 (81%)
hoxb8XP_002938067.1 Homeobox 149..202 CDD:365835 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.