DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxc5

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_002936695.2 Gene:hoxc5 / 100487879 XenbaseID:XB-GENE-485672 Length:225 Species:Xenopus tropicalis


Alignment Length:211 Identity:86/211 - (40%)
Similarity:106/211 - (50%) Gaps:51/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 GSNN--------NNNSANSNNNNSQSLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLA 242
            ||:|        :|.:|||...:...:.|             |..:|......:||.|:..    
 Frog    53 GSSNSLSALDMPSNPNANSERPSCTVMGS-------------SGHTVGRGEQSALNSGIYN---- 100

  Fly   243 AAAAAAGLNNNHSG-SGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYP 306
            ..||...|.....| ..:...|.     ..:|.||....:.               ::.||||||
 Frog   101 QKAATTSLEERSKGIESIKTEPA-----QSTPQGGQPQQQQ---------------QQQPPQIYP 145

  Fly   307 WMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIW 371
            ||.::|:...|     :.||.|||||||||||||||||||||||||||||||:.|||.|||||||
 Frog   146 WMTKLHMSHET-----DGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIW 205

  Fly   372 FQNRRMKWKKEHKMAS 387
            ||||||||||:.|:.|
 Frog   206 FQNRRMKWKKDTKVKS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 49/52 (94%)
hoxc5XP_002936695.2 Homeobox 161..215 CDD:395001 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm48005
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.