DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxa6

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_002933441.2 Gene:hoxa6 / 100485428 XenbaseID:XB-GENE-481964 Length:237 Species:Xenopus tropicalis


Alignment Length:148 Identity:73/148 - (49%)
Similarity:89/148 - (60%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 HSGSGVSGGPGNVNVPMHSPGG------GDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVH 312
            :||...||.|.:.........|      .|......:..:..........:|....:||||:||:
 Frog    80 YSGKESSGSPSSYGTKHRGDSGEYLHFSADQQQYKSASAQGKMLHEEPTDRKYSSPVYPWMQRVN 144

  Fly   313 LGTSTV-NANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRR 376
            ..|..| .|:|  :|.|.:|||:||||||||||||||||||||||||:|||||||||||||||||
 Frog   145 SCTGPVYGAHG--RRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRR 207

  Fly   377 MKWKKEHKMASMNIVPYH 394
            ||||||.|:    ::|.|
 Frog   208 MKWKKESKL----LLPSH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 48/52 (92%)
hoxa6XP_002933441.2 Homeobox 159..212 CDD:365835 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.