DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxb2

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_002727852.1 Gene:Hoxb2 / 100361765 RGDID:2319509 Length:355 Species:Rattus norvegicus


Alignment Length:316 Identity:92/316 - (29%)
Similarity:119/316 - (37%) Gaps:112/316 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 GSSQNSGNGK--KNPPQI--------YPWMKRVHL-------------GTSTVNANG-------- 322
            ||.:.:|:|.  :.||.:        :||||....             ..|:|.|:|        
  Rat    68 GSQKPAGDGPALRPPPPLPVAPPAPEFPWMKEKKSAKKPSQSAATPSPAASSVRASGVGSPSDGP 132

  Fly   323 --------ETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 379
                    .::|.||:||..|.||||||||||:||.|.||:|||..|.|||||:|:|||||||| 
  Rat   133 GLPESGGSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMK- 196

  Fly   380 KKEHKMASMNIVPYHMGPYGHP---YHQFDI-HPSQFAHLSAXDAWHFSGTGXRLNQLYQEPYQT 440
               ||..:.:..|    |.|.|   ..|.|. .|::...:|..|.     ...||.:....|   
  Rat   197 ---HKRQTQHREP----PDGEPGGLSAQDDAGEPAEEPTVSPGDV-----ASHRLREACFLP--- 246

  Fly   441 AAAASAASGYQSQDGGPIGGGSVGVGGGAGGPGSLANGGSNGSGPNSLFASAASSSQAPDCIKYP 505
               |.||.|.:                  |.|..|.        |.:...|..:||  |.|    
  Rat   247 ---AEAAQGPR------------------GAPPPLP--------PATALESVGASS--PGC---- 276

  Fly   506 QEFXSQVIIRQQHQQQQDNSMDRNQER-------DLKLLLETDCEP-----DPELQ 549
                  .::|....|.:....|...||       ||.......|.|     .|.||
  Rat   277 ------TMLRAGGLQSEPLPEDACPERQDSPFLPDLNFFAADSCLPMSGGLSPSLQ 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 38/52 (73%)
Hoxb2XP_002727852.1 Homeobox 146..198 CDD:278475 38/55 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.