DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and LHX2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_004780.3 Gene:LHX2 / 9355 HGNCID:6594 Length:406 Species:Homo sapiens


Alignment Length:210 Identity:45/210 - (21%)
Similarity:80/210 - (38%) Gaps:55/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 LGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQI 378
            |..|:||.:..|.|..              ||..:|                .||.||::..||:
Human   244 LSCNENDAEHLDRDQP--------------YPSSQK----------------TKRMRTSFKHHQL 278

  Fly   379 LELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDA--- 440
            ..::..|..|.....:...::|....|::|.:::||||.|.|::: |.|........|:.||   
Human   279 RTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR-NLLRQENTGVDKSTDAALQ 342

  Fly   441 NGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSL-----G 500
            .|.|:..|.:.:..:.|                ...||.....:.|.:|.::..|.:|:     |
Human   343 TGTPSGPASELSNASLS----------------PSSTPTTLTDLTSPTLPTVTSVLTSVPGNLEG 391

  Fly   501 NPPYIPAAPETTSSY 515
            :.|:.|:....|:.:
Human   392 HEPHSPSQTTLTNLF 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 15/51 (29%)
LHX2NP_004780.3 LIM1_Lhx2 43..106 CDD:188853
LIM2_Lhx2_Lhx9 111..169 CDD:188763
COG5576 <247..378 CDD:227863 38/177 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..270 8/49 (16%)
Homeobox 270..323 CDD:395001 15/52 (29%)
Nuclear localization signal. /evidence=ECO:0000255 307..323 7/15 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..374 10/61 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.