DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and LHX4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_203129.1 Gene:LHX4 / 89884 HGNCID:21734 Length:390 Species:Homo sapiens


Alignment Length:214 Identity:46/214 - (21%)
Similarity:83/214 - (38%) Gaps:46/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 DEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTR 393
            ||..:.|  ||..:    .|:.:.....|...:.|  .||.||..|..|:..|:..:..:....|
Human   128 DEFYLME--DGRLV----CKEDYETAKQNDDSEAG--AKRPRTTITAKQLETLKNAYKNSPKPAR 184

  Fly   394 RRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASK 458
            ..|.:::....|..|.:::||||||.|.|:..|            ||..:......|..||:...
Human   185 HVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK------------DAGRHRWGQFYKSVKRSRGS 237

  Fly   459 KQQQAQQQQQ-----SQQQQTQQTPVMNECIRSDSL-ESIGDVSSSL------------------ 499
            .:|:.:...:     ..:...::..:::|...::.: .::|||:...                  
Human   238 SKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDL 302

  Fly   500 --GNPPYIPAAPETTSSYP 516
              |:|..||.:|.:.||.|
Human   303 RDGSPYGIPQSPSSISSLP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 16/51 (31%)
LHX4NP_203129.1 LIM1_Lhx4 30..81 CDD:188852
LIM2_Lhx3_Lhx4 89..144 CDD:188762 6/21 (29%)
Homeobox 160..213 CDD:306543 16/52 (31%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 161..181 5/19 (26%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 199..211 7/11 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..253 3/22 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.