DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and YOX1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_013685.1 Gene:YOX1 / 854981 SGDID:S000004489 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:72/331 - (21%)
Similarity:119/331 - (35%) Gaps:72/331 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 PPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDM---SEEDRLM------ 306
            ||.||::....   .:|..:...|.:   |.|        :..:..|||   ::.|..:      
Yeast    47 PPLNTSINRPR---SVESALRHTVTS---LHE--------NSSAYGDDMLKHTQSDSALSSQLNS 97

  Fly   307 ----LDRSPDEL---GSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQ--- 361
                :|.|.:.|   ..|....|...|....|::...:..:.||.|...|......|..::.   
Yeast    98 SQETVDESHENLLLTPLNSKKRDYSVSSKKNDILTPLSAAKSIIIPSASKEKRRAFAFITHSQET 162

  Fly   362 -PGMEPK--------RQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNR 417
             |..|||        |:|...:..::..|:.||......::.:|||:|.:..::|:.::|||||:
Yeast   163 FPKKEPKIDNAPLARRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNK 227

  Fly   418 RMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNE 482
            |...|:.....:......:||.....|..|...|   .||:.:....:...|             
Yeast   228 RQAVKRQRIATSKSTTIIQTVSPPSPPLDVHATP---LASRVKADILRDGSS------------- 276

  Fly   483 CIRSDSLESIGDVSSSLGNPPYIP----AAPETTSSYPGSQQ---HLSNNNNNGSGNNNNNNNNN 540
            |.||.|       ||.|.|.|..|    ....:|.|...||.   ||:......:....:.|:..
Yeast   277 CSRSSS-------SSPLENTPPRPHHSLNRRSSTPSIKRSQALTFHLNPQKKTLTPVKTSPNSRV 334

  Fly   541 NSNLNN 546
            |..:|:
Yeast   335 NKLINS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 15/51 (29%)
YOX1NP_013685.1 COG5576 126..267 CDD:227863 34/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.