DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HB18

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_177248.3 Gene:HB18 / 843431 AraportID:AT1G70920 Length:206 Species:Arabidopsis thaliana


Alignment Length:199 Identity:48/199 - (24%)
Similarity:77/199 - (38%) Gaps:76/199 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDD 298
            ||:|..:||.:...|..|  :.:||                      ...|||    |.......
plant     4 SPNSSSLDLTISIPSFSP--SPSLG----------------------DHHGMR----DFDINQTP 40

  Fly   299 MSEEDR-LMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQP 362
            .:|||| .|:..:|     :.|:||             :..|.|                     
plant    41 KTEEDREWMIGATP-----HVNEDD-------------SNSGGR--------------------- 66

  Fly   363 GMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL 427
                :|::...|:.|...||:.|..|..||.:::.::|..|.||:||:::||||||.:    :||
plant    67 ----RRKKLRLTKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRAR----SKL 123

  Fly   428 PNTK 431
            .:|:
plant   124 KHTE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 20/51 (39%)
HB18NP_177248.3 HOX 66..122 CDD:197696 22/84 (26%)
HALZ 124..167 CDD:420073 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.