DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and ATHB13

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_177136.1 Gene:ATHB13 / 843314 AraportID:AT1G69780 Length:294 Species:Arabidopsis thaliana


Alignment Length:296 Identity:76/296 - (25%)
Similarity:115/296 - (38%) Gaps:95/296 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 RSPD------ELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPK 367
            |||.      |.|:|.|    |:.|..:|                          || |.| |.|
plant    54 RSPMEGCCDLETGNNMN----GEEDYSDD--------------------------GS-QMG-EKK 86

  Fly   368 RQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKN 432
            |:   ....|:..|||.|.....|...|::::|..|.|..|||.|||||||.:| |..:|....:
plant    87 RR---LNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARW-KTKQLEKDYD 147

  Fly   433 VRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQ------QQQTQQTPVMNE----CIR-- 485
            ..|:..|            |.:|.:...|...|:.|::      ::||:...:..|    |..  
plant   148 TLKRQFD------------TLKAENDLLQTHNQKLQAEIMGLKNREQTESINLNKETEGSCSNRS 200

  Fly   486 ---SDSLESIGDVS-------SSL--GNPP--------YIPAAPETTSSYPGSQQHLSNNNNNGS 530
               ||:|..  |:|       |:|  |:||        :.|.:|.|.::...:.|...|::   |
plant   201 DNSSDNLRL--DISTAPPSNDSTLTGGHPPPPQTVGRHFFPPSPATATTTTTTMQFFQNSS---S 260

  Fly   531 GNNNNNNNNNNSNLNNNNNNNQMGHTNLHGHLQQQQ 566
            |.:.....|:.||:....::    |:.....|.|||
plant   261 GQSMVKEENSISNMFCAMDD----HSGFWPWLDQQQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 20/51 (39%)
ATHB13NP_177136.1 Homeobox 85..138 CDD:395001 23/56 (41%)
HALZ 140..182 CDD:396657 8/53 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.