DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AtHB23

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 / 839587 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana


Alignment Length:281 Identity:68/281 - (24%)
Similarity:107/281 - (38%) Gaps:92/281 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 GMRLRCDDMGSENDDMSEED--RLMLD-------RSP-DELGSNDNDDDLGDSDSDEDLMAETTD 338
            |:....::...:|....|||  :|:.|       ||| :.:....|.|..||.:..:|       
plant     7 GLAFFPENFSLQNHHQEEEDHPQLLQDFHGFLGKRSPMNNVQGFCNLDMNGDEEYSDD------- 64

  Fly   339 GERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTL 403
                               ||   .|..|::|  ....|:..|||:|.....|...|::|:|..|
plant    65 -------------------GS---KMGEKKRR--LNMEQLKALEKDFELGNKLESDRKLELARAL 105

  Fly   404 VLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQ 468
            .|..|||.|||||||.: .|..:|....::.|:..:                 |.:.:....|.|
plant   106 GLQPRQIAIWFQNRRAR-SKTKQLEKDYDMLKRQFE-----------------SLRDENEVLQTQ 152

  Fly   469 SQQQQTQ------QTPV----MNE-----CIRSDSLESI-GDV-------SSSLGNPPYIPAAPE 510
            :|:.|.|      :.|:    :|:     |  ||..|:| ||:       ..:||:||     ..
plant   153 NQKLQAQVMALKSREPIESINLNKETEGSC--SDRSENISGDIRPPEIDSQFALGHPP-----TT 210

  Fly   511 TTSSY---PGSQQHLSNNNNN 528
            ||..:   ..|:|.:....|:
plant   211 TTMQFFQNSSSEQRMVKEENS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696 23/55 (42%)
HALZ 126..168 CDD:396657 8/58 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.