DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HAT2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_199548.1 Gene:HAT2 / 834784 AraportID:AT5G47370 Length:283 Species:Arabidopsis thaliana


Alignment Length:298 Identity:67/298 - (22%)
Similarity:107/298 - (35%) Gaps:94/298 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLK--------LEKRIEEAVPAGQQLQELGMR 286
            ||.|:        ||| .:..|.::.:..||.|...        |.|....:.|:....:|    
plant    17 SQNHN--------PLQ-MNLNPNSSLSNNLQRLPWNQTFDPTSDLRKIDVNSFPSTVNCEE---- 68

  Fly   287 LRCDDMGSENDDMSEEDRLMLDRSPDE------LGSNDNDDDL--------GDSDSDEDLMAETT 337
                |.|..:.:.:....:...||..|      :||.|:.|::        |.||.:||      
plant    69 ----DTGVSSPNSTISSTISGKRSEREGISGTGVGSGDDHDEITPDRGYSRGTSDEEED------ 123

  Fly   338 DGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHT 402
                                     |.|..|::...::.|...||:.|..:..|..::::.:|..
plant   124 -------------------------GGETSRKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKK 163

  Fly   403 LVLSERQIKIWFQNRRMKWKKDNKLPNT-------KNVRKKTVDANGNPTPVAKKPTKRAASKKQ 460
            |.|:.||:::||||||.:    .||..|       |...:|..:.|            |...|:.
plant   164 LNLTARQVEVWFQNRRAR----TKLKQTEVDCEYLKRCVEKLTEEN------------RRLQKEA 212

  Fly   461 QQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSS 498
            .:.:..:.|.|...|.|| ....|...|.|.:|..|||
plant   213 MELRTLKLSPQFYGQMTP-PTTLIMCPSCERVGGPSSS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 16/51 (31%)
HAT2NP_199548.1 HD-ZIP_N 8..91 CDD:398351 18/90 (20%)
HOX 129..183 CDD:197696 17/57 (30%)
HALZ 185..228 CDD:128634 8/54 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.