DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HB51

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:238 Identity:48/238 - (20%)
Similarity:84/238 - (35%) Gaps:70/238 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 PW--------MKKIHVAGVANGSYQPG----------MEPKRQRTAY---------------TRH 376
            ||        :...:....|..||.||          .|.::...||               |..
plant    20 PWPESSSFNSLHSFNFDPYAGNSYTPGDTQTGPVISVPESEKIMNAYRFPNNNNEMIKKKRLTSG 84

  Fly   377 QILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDAN 441
            |:..||:.|.....|...|:::::..|.|..|||.:||||||.:||. .:|....:..::..|  
plant    85 QLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWKA-KQLEQLYDSLRQEYD-- 146

  Fly   442 GNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIG-----DVSSSLGN 501
                         ..|:::|....:.:..:...:...::.:.|.:.:::..|     ::||    
plant   147 -------------VVSREKQMLHDEVKKLRALLRDQGLIKKQISAGTIKVSGEEDTVEISS---- 194

  Fly   502 PPYIPAAPETTSSYPGSQQHLSNNNNNGSGNNNNNNNNNNSNL 544
              .:.|.|.|.:.          |.|..:|.|......||..|
plant   195 --VVVAHPRTENM----------NANQITGGNQVYGQYNNPML 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 20/66 (30%)
HB51NP_195999.2 Homeobox 77..130 CDD:395001 18/52 (35%)
HALZ 132..167 CDD:396657 4/49 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.