DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HB-3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:243 Identity:55/243 - (22%)
Similarity:91/243 - (37%) Gaps:82/243 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 MLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQR 370
            :..:||....:.::.|.:|:.|:..|      ||..::.                  |.:.||  
plant    80 LTQKSPTTTNNMNDQDQVGEEDNLSD------DGSHMML------------------GEKKKR-- 118

  Fly   371 TAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRK 435
              ....|:..|||.|.....|...|::::|..|.|..|||.|||||||.:| |..:|....:..|
plant   119 --LNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARW-KTKQLERDYDSLK 180

  Fly   436 KTVDA--NGNPTPVA---KKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDV 495
            |..|.  :.|.:.:|   |...:..|.||..:.:..:                |:.:..|     
plant   181 KQFDVLKSDNDSLLAHNKKLHAELVALKKHDRKESAK----------------IKREFAE----- 224

  Fly   496 SSSLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGSGNNNNNNNNNNSN 543
                                       ::.:||||..||:|||::::|
plant   225 ---------------------------ASWSNNGSTENNHNNNSSDAN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 20/51 (39%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 23/57 (40%)
HALZ 170..208 CDD:280364 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.