DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HAT22

DIOPT Version :10

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_195493.1 Gene:HAT22 / 829935 AraportID:AT4G37790 Length:278 Species:Arabidopsis thaliana


Alignment Length:157 Identity:38/157 - (24%)
Similarity:64/157 - (40%) Gaps:36/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 RIEEAVPAGQQLQELGMRLRCDDMGSENDDMS-EEDRLMLDRSPDELGSNDNDDDLGDSDSDEDL 332
            :|:....||.|:        |....|.:...| ...|:..:|   |:...|.:::          
plant    56 KIKTGAGAGDQI--------CRQTSSHSGISSFSSGRVKRER---EISGGDGEEE---------- 99

  Fly   333 MAETTDGERIIYPWMKKIH--VAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRR 395
            ..|||  ||::...:...|  ..||:          .|::...|:.|...||..|..:..|..::
plant   100 AEETT--ERVVCSRVSDDHDDEEGVS----------ARKKLRLTKQQSALLEDNFKLHSTLNPKQ 152

  Fly   396 RIEIAHTLVLSERQIKIWFQNRRMKWK 422
            :..:|..|.|..||:::||||||.:.|
plant   153 KQALARQLNLRPRQVEVWFQNRRARTK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeodomain 367..423 CDD:459649 19/56 (34%)
HAT22NP_195493.1 Homeodomain 125..179 CDD:459649 18/53 (34%)
HALZ 181..224 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.