DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HB-2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 / 827384 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana


Alignment Length:146 Identity:36/146 - (24%)
Similarity:65/146 - (44%) Gaps:38/146 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 NDDMSEEDR------LMLDRSPD--ELGSNDNDDDLGDSDSDEDLMAET---------TD--GER 341
            |.|.|:::.      :.::|.|.  |.|    |:|.|.|..:..:.:.|         ||  |.|
plant    56 NSDSSQKETRTFIRGIDVNRPPSTAEYG----DEDAGVSSPNSTVSSSTGKRSEREEDTDPQGSR 116

  Fly   342 IIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLS 406
                        |:::.  :.| :..|::...::.|...||:.|..:..|..:::..:|..|.|.
plant   117 ------------GISDD--EDG-DNSRKKLRLSKDQSAILEETFKDHSTLNPKQKQALAKQLGLR 166

  Fly   407 ERQIKIWFQNRRMKWK 422
            .||:::||||||.:.|
plant   167 ARQVEVWFQNRRARTK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 16/51 (31%)
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:282474 12/54 (22%)
HOX 128..182 CDD:197696 17/53 (32%)
HALZ 184..227 CDD:128634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.