DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HAT3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:292 Identity:58/292 - (19%)
Similarity:100/292 - (34%) Gaps:90/292 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDD 298
            :|.:.::|:..:.:....|.:|...:.. |.|.|:.:..|..|               :|....:
plant    84 APSTVVVDVEDEGAGVSSPNSTVSSVMS-GKKSERELMAAAGA---------------VGGGRVE 132

  Fly   299 MSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPG 363
            .:|     ::|:...||...:|:|                               |..||.    
plant   133 DNE-----IERASCSLGGGSDDED-------------------------------GSGNGD---- 157

  Fly   364 MEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLP 428
             :..|::...::.|.|.||:.|..:..|..::::.:|..|.|..||:::||||||.:    .||.
plant   158 -DSSRKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRAR----TKLK 217

  Fly   429 NT-------KNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTP--VMNECI 484
            .|       |...:...|.|            |...|:..:.:..:.|........|  .:..| 
plant   218 QTEVDCEYLKRCCENLTDEN------------RRLQKEVSELRALKLSPHLYMHMKPPTTLTMC- 269

  Fly   485 RSDSLESIGDVSSSLGNPPYIPAAPETTSSYP 516
              .|.|.:...|||....|     |...||.|
plant   270 --PSCERVAVTSSSSSVAP-----PVMNSSSP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 17/51 (33%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:398351 7/34 (21%)
Homeobox 165..215 CDD:395001 17/53 (32%)
HALZ 217..260 CDD:128634 7/54 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.