DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HB20

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:339 Identity:63/339 - (18%)
Similarity:127/339 - (37%) Gaps:110/339 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 ELGLKLEKRIEEAVPA-GQQLQELGMRLRCDDMGSENDDMSEED-------------RLMLDRSP 311
            |.||    |:|.|.|. |...|:|            ::|.|::.             ..|::||.
plant     9 EAGL----RLEMAFPQHGFMFQQL------------HEDNSQDQLPSCPPHLFNGGGNYMMNRSM 57

  Fly   312 DELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRH 376
            ..:...::.:...|.::..|..|.|..||:     .|::.:                       .
plant    58 SLMNVQEDHNQTLDEENLSDDGAHTMLGEK-----KKRLQL-----------------------E 94

  Fly   377 QILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDA- 440
            |:..|||.|.....|...|:|::|..|.:..|||.|||||||.:| |..:|....:..||..:: 
plant    95 QVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARW-KTRQLERDYDSLKKQFESL 158

  Fly   441 ---NGNPTPVAKKPTKRAASKKQQQAQQ----QQQSQQQQTQQTPVMNECIRSDSLESIGDVSSS 498
               |.:.....||......:.|.::..:    :::::...:          .:.|.|:..|::..
plant   159 KSDNASLLAYNKKLLAEVMALKNKECNEGNIVKREAEASWS----------NNGSTENSSDINLE 213

  Fly   499 LGNPPYIPAAPETTSSYPGSQQHLSNNNNNGSGNNNNNNNNNN---------------------- 541
            :..        ||.:::..:.:.|..::...|.::::::.|:.                      
plant   214 MPR--------ETITTHVNTIKDLFPSSIRSSAHDDDHHQNHEIVQEESLCNMFNGIDETTPAGY 270

  Fly   542 ---SNLNNNNNNNQ 552
               |:.|:|::::|
plant   271 WAWSDPNHNHHHHQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 20/51 (39%)
HB20NP_186771.1 HOX 87..140 CDD:197696 22/81 (27%)
HALZ 142..183 CDD:280364 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.