DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HB-1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_186796.1 Gene:HB-1 / 821138 AraportID:AT3G01470 Length:272 Species:Arabidopsis thaliana


Alignment Length:189 Identity:46/189 - (24%)
Similarity:85/189 - (44%) Gaps:16/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 YQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKD 424
            |...:..|::|  .|..|:..|||.|.....|...|:.::|..|.|..||:.:||||||.:| |.
plant    61 YDDQLPEKKRR--LTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARW-KT 122

  Fly   425 NKLPNTKNVRKKTVD---ANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNE---- 482
            .:|....::.|.|.|   :|.:...:.....:...:...::.|.:|::..:...|.|..|:    
plant   123 KQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSLTEKLQGKQETANEPPGQVPEPNQLDPV 187

  Fly   483 -----CIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGSGNNNNN 536
                 .|:::...|.|.|.|::.:.. .|...::..||..|...:.:|:|....:|:.:
plant   188 YINAAAIKTEDRLSSGSVGSAVLDDD-APQLLDSCDSYFPSIVPIQDNSNASDHDNDRS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 20/51 (39%)
HB-1NP_186796.1 HOX 66..121 CDD:197696 22/57 (39%)
HALZ 123..165 CDD:396657 5/41 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.