DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Msx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_112321.2 Gene:Msx1 / 81710 RGDID:620929 Length:303 Species:Rattus norvegicus


Alignment Length:323 Identity:77/323 - (23%)
Similarity:105/323 - (32%) Gaps:123/323 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLP-----LQCSSTE 250
            |||:|...|..|...:|.|                  |..:|..|......||     |.....:
  Rat    26 GGGAGQAPGAAAATATAMG------------------TDEEGAKPKVPASLLPFSVEALMADHRK 72

  Fly   251 PPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMR---LRCDDMGSENDDMSE----------E 302
            |      |.:|..|...   |.|..||..:|.||.|   |...|..|....:..          |
  Rat    73 P------GAKESVLVAS---EGAQAAGGSVQHLGTRPGSLGAPDAPSSPGPLGHFSVGGLLKLPE 128

  Fly   303 DRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEP- 366
            |.|:...||::|...                           |||:            .|...| 
  Rat   129 DALVKAESPEKLDRT---------------------------PWMQ------------SPRFSPP 154

  Fly   367 ------------------KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIW 413
                              ::.||.:|..|:|.||::|...:||:...|.|.:.:|.|:|.|:|||
  Rat   155 PARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIW 219

  Fly   414 FQNRRMKWKK--DNKLPNTKNVRKKTVDAN--------GNPTPV----------AKKPTKRAA 456
            |||||.|.|:  :.:|...|...|..:...        |.|..|          |..|.:|||
  Rat   220 FQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYSASGPFQRAA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
Msx1NP_112321.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.