DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HAT9

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_179865.1 Gene:HAT9 / 816811 AraportID:AT2G22800 Length:274 Species:Arabidopsis thaliana


Alignment Length:216 Identity:44/216 - (20%)
Similarity:77/216 - (35%) Gaps:61/216 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 DLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGME--PKRQRTAYTRHQILELEKE 384
            |.|:...:|:.|.     ||:|              ..|....|  ..|::...|:.|...||:.
plant    83 DGGEESPEEEEMT-----ERVI--------------SDYHEDEEGISARKKLRLTKQQSALLEES 128

  Fly   385 FHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAK 449
            |..:..|..:::..:|..|.|..||:::||||||.:.|          :::..||..     ..|
plant   129 FKDHSTLNPKQKQVLARQLNLRPRQVEVWFQNRRARTK----------LKQTEVDCE-----FLK 178

  Fly   450 KPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSS 514
            |..:..|   .:..:.|::.|:.:|.:                      |..|.|:.....|.:.
plant   179 KCCETLA---DENIRLQKEIQELKTLK----------------------LTQPFYMHMPASTLTK 218

  Fly   515 YPGSQQHLSNNNNNGSGNNNN 535
            .|..::.......||.|...:
plant   219 CPSCERIGGGGGGNGGGGGGS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 17/51 (33%)
HAT9NP_179865.1 HOX 112..166 CDD:197696 18/53 (34%)
HALZ 168..211 CDD:128634 11/72 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.