DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and HB6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:276 Identity:55/276 - (19%)
Similarity:108/276 - (39%) Gaps:78/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 DRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTA 372
            ::||...|..:....|...:.:|:.:.|            ::.||          |:..|::|.:
plant    25 EQSPRRYGGREFQSMLEGYEEEEEAIVE------------ERGHV----------GLSEKKRRLS 67

  Fly   373 YTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK-------------- 423
            .  :|:..|||.|.....|...|::::|..|.|..||:.:||||||.:||.              
plant    68 I--NQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKTQY 130

  Fly   424 DNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDS 488
            |:...|..::|:   |.......::|..||......:::.::.              |..:.::|
plant   131 DSLRHNFDSLRR---DNESLLQEISKLKTKLNGGGGEEEEEEN--------------NAAVTTES 178

  Fly   489 LESIGDVSSSLGNPPYIPAAPETTSSYPGSQQHLSNNN------------------NNGSGNNNN 535
            ..|:.:...||  |..|..||   ||.|...:|....|                  :..:...::
plant   179 DISVKEEEVSL--PEKITEAP---SSPPQFLEHSDGLNYRSFTDLRDLLPLKAAASSFAAAAGSS 238

  Fly   536 NNNNNNSNLNNNNNNN 551
            :::::::.||..:::|
plant   239 DSSDSSALLNEESSSN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 19/51 (37%)
HB6NP_565536.1 Homeobox 62..115 CDD:278475 20/54 (37%)
HALZ 117..158 CDD:280364 6/43 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.