powered by:
Protein Alignment Dfd and HB21
DIOPT Version :9
Sequence 1: | NP_477201.1 |
Gene: | Dfd / 40832 |
FlyBaseID: | FBgn0000439 |
Length: | 586 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_179445.1 |
Gene: | HB21 / 816370 |
AraportID: | AT2G18550 |
Length: | 220 |
Species: | Arabidopsis thaliana |
Alignment Length: | 65 |
Identity: | 23/65 - (35%) |
Similarity: | 34/65 - (52%) |
Gaps: | 3/65 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 377 QILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK---DNKLPNTKNVRKKTV 438
|:..||..|..:..|...|:..:|..|.|..||:.:||||||.:||. :::....||..:.||
plant 69 QVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVEDEYTKLKNAYETTV 133
Fly 439 438
plant 134 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.