Sequence 1: | NP_477201.1 | Gene: | Dfd / 40832 | FlyBaseID: | FBgn0000439 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_008913.2 | Gene: | ALX1 / 8092 | HGNCID: | 1494 | Length: | 326 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 52/201 - (25%) |
---|---|---|---|
Similarity: | 82/201 - (40%) | Gaps: | 48/201 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 367 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTK 431
Fly 432 NVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQ-QQQQSQQQQTQQTPVMNECIRSDSLESI--- 492
Fly 493 ---GDVSSSLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGSGNNNNNNNNNNSNLNNNNNNNQM- 553
Fly 554 GHTNLH 559 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dfd | NP_477201.1 | Homeobox | 370..422 | CDD:278475 | 21/51 (41%) |
ALX1 | NP_008913.2 | Homeobox | 135..189 | CDD:365835 | 22/88 (25%) |
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 | 192..326 | 28/107 (26%) | |||
OAR | 302..320 | CDD:367680 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 306..319 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |