DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and lbx1b

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001156784.1 Gene:lbx1b / 793810 ZFINID:ZDB-GENE-050309-27 Length:265 Species:Danio rerio


Alignment Length:297 Identity:75/297 - (25%)
Similarity:112/297 - (37%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 GSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALG--LQELGLKLEKRIEEAVPAGQQLQELGMRLR 288
            |:..|:|.:|   :..||...||.:|.|..::.  |.:..:|...||.              ||.
Zfish    11 GAMESRGLNP---LDHLPPPASSNKPLTPFSITDILSKPTVKRFHRIH--------------RLP 58

  Fly   289 CDDMGSENDDMSEEDRLMLDRSP----DELGSND-NDDDLGDSDSDEDLMAETTDGERIIYPWMK 348
            ..|...::..:|.: .|:...||    .||.|.. ...:||...:     ||..||.::.     
Zfish    59 ASDRVRQSITVSRQ-TLITQASPLCALQELASKTFKGLELGVLQA-----AEGKDGLKLF----- 112

  Fly   349 KIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIW 413
                     |......:.::.|||:|.||:.||||.|.:.:||:...|.:|||.|.|:..|:..|
Zfish   113 ---------GQRDSPKKRRKSRTAFTNHQLYELEKRFLHQKYLSPADRDQIAHQLGLTNAQVITW 168

  Fly   414 FQNRRMKWKKD-------------------NKLPNTKNV-RKKTVDANGNPTPVAKKPTKRAASK 458
            |||||.|.|:|                   :||....:: |.....|.|||.|............
Zfish   169 FQNRRAKLKRDLEEMKADVESVRSTGLVPLDKLAKLADLERCAAAGATGNPGPQCSPRLGHEYKT 233

  Fly   459 KQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDV 495
            ..:.......|....|.|     :|...:.:|...||
Zfish   234 VHKLCLSPMSSLSDHTSQ-----DCSEDEEVEIDVDV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 27/51 (53%)
lbx1bNP_001156784.1 Homeobox 124..178 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.