DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxa5

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_077365.1 Gene:Hoxa5 / 79241 RGDID:620609 Length:381 Species:Rattus norvegicus


Alignment Length:458 Identity:129/458 - (28%)
Similarity:164/458 - (35%) Gaps:187/458 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PPLADDYHHYNGHYSMTASTGHMSGAVGG-------------GAGVGS----------------V 65
            |||..::          .|.||.:|...|             ||.||.                .
  Rat    37 PPLLHEF----------TSRGHQAGFTTGQQKHVIRSRTPYLGAYVGGNRVHVPVISIIHHKLCK 91

  Fly    66 GGGGAGGMTGHPHSMHPADMVS---------------DYMAHHHNPHS----------HSHSHTH 105
            |...|.....|..|.|....:|               ||..|::..||          ..||..:
  Rat    92 GAIDAQTTASHKSSTHIKKQMSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRY 156

  Fly   106 SLPHHHSNSAI----SGHHQAS--AGGYSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFIS 164
            ...::..:.::    |||..:.  |..|::. |:|.|....:|.|                    
  Rat   157 GYGYNGMDLSVGRSGSGHFGSGERARSYAAG-ASAAPAEPRYSQP-------------------- 200

  Fly   165 AGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTH 229
            |.:.||.|.:....:|..|:..:....||..::  |.:.|.|||                .||||
  Rat   201 ATSTHSPPPDPLPCSAVAPSPGSDSHHGGKNSL--GNSSGASAN----------------AGSTH 247

  Fly   230 SQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGS 294
                            .||.|            |:......||..||.                 
  Rat   248 ----------------ISSRE------------GVGTASAAEEDAPAS----------------- 267

  Fly   295 ENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGS 359
                 ||:.....:.||                        ....:..|||||:|:|::....| 
  Rat   268 -----SEQAGAQSEPSP------------------------APPAQPQIYPWMRKLHISHDNIG- 302

  Fly   360 YQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKD 424
               |.|.||.||||||:|.||||||||:||||||||||||||.|.||||||||||||||||||||
  Rat   303 ---GPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKD 364

  Fly   425 NKL 427
            |||
  Rat   365 NKL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 46/51 (90%)
Hoxa5NP_077365.1 Homeobox 310..363 CDD:365835 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.