DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hmx3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001072829.1 Gene:hmx3 / 780290 XenbaseID:XB-GENE-483776 Length:306 Species:Xenopus tropicalis


Alignment Length:313 Identity:75/313 - (23%)
Similarity:114/313 - (36%) Gaps:115/313 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 YGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQ--- 279
            |..|:|        ||:|.:::.|..|....|.|                      |..|::   
 Frog    88 YTLAHG--------GHTPRTEVPDKSLLLGPTSP----------------------VSGGERDSP 122

  Fly   280 --LQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERI 342
              :..|...|...|..|::     .:.::|:.|..|.|..|        ||.||           
 Frog   123 EPIHPLKAELEAKDSESKS-----PEEIILEESEPEEGKKD--------DSGED----------- 163

  Fly   343 IYPWMKKIHVAGVANGSYQPGMEP---KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLV 404
               |.|:         ...|..:|   |:.||.::|.|:.:||..|...|||:...|..:|.:|.
 Frog   164 ---WKKR---------EESPDKKPCRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLH 216

  Fly   405 LSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQS 469
            |:|.|:||||||||.|||:                             :.||   :.:|.....:
 Frog   217 LTETQVKIWFQNRRNKWKR-----------------------------QLAA---ELEAANLSHA 249

  Fly   470 QQQQTQQTPVM-NECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYPGSQQH 521
            ..|:..:.|:: :|  .|.|.||    :||..|.|.  :.|..|..:|....|
 Frog   250 AAQRIVRVPILYHE--NSSSAES----ASSAANVPV--SQPLLTFPHPVYYSH 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
hmx3NP_001072829.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..181 26/143 (18%)
Homeobox 181..235 CDD:365835 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.