DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Vsx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001103016.1 Gene:Vsx1 / 689704 RGDID:1305667 Length:369 Species:Rattus norvegicus


Alignment Length:329 Identity:77/329 - (23%)
Similarity:114/329 - (34%) Gaps:103/329 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GYGTANGSVGSTHSQGHSPHSQMMDLPLQCS-STEPPTNTA-----LGLQELGLKLEKRIEEAVP 275
            |.|...|..|:..::|..|    :.|.|.|. ..:||:.||     |.|.:|.|......|.||.
  Rat    63 GPGPGPGLCGTCPARGALP----LGLGLLCGFGAQPPSATAARARCLLLADLRLLPPAGPEPAVA 123

  Fly   276 AGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDL----GDSDSDE--DLMA 334
            ....                             ..|..|||....:::    |||.|:|  |...
  Rat   124 QSPV-----------------------------HPPPALGSQQRSENISTSDGDSPSEEKNDPKM 159

  Fly   335 ETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEI 399
            ..|.|:|      ||                 :|.||.:|.||:.||||.|....|.....|..:
  Rat   160 SLTLGKR------KK-----------------RRHRTVFTAHQLEELEKAFGEAHYPDVYAREML 201

  Fly   400 AHTLVLSERQIKIWFQNRRMKWKKDNK---------------------LPNTKNVRKKTVDANGN 443
            |....|.|.:|::||||||.||:|..|                     :|...:|........|:
  Rat   202 AVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSADSLQGS 266

  Fly   444 PTP----VAKKPTKRAASKKQQQ---------AQQQQQSQQQQTQQTPVMNECIRSDSLESIG-D 494
            ..|    :.||.|:....:.:::         .::..:..:...::.|.........|||.:. |
  Rat   267 CAPWLLGMHKKSTEMRKPESEEKLAGLWELDHLRKGAKKDEDGPERGPGKASLNPEGSLEDVAID 331

  Fly   495 VSSS 498
            :|||
  Rat   332 LSSS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 23/51 (45%)
Vsx1NP_001103016.1 Homeobox 171..224 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.