DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxd9

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001166940.1 Gene:Hoxd9 / 688999 RGDID:1582908 Length:343 Species:Rattus norvegicus


Alignment Length:325 Identity:97/325 - (29%)
Similarity:122/325 - (37%) Gaps:93/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ATPPS--------HPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGG 190
            |.||:        ||:..|........|.||....|          |..|:...|.....|.|||
  Rat    73 AQPPAAATMSGLYHPYVSPPPLAAAEPGRYVRSWME----------PLPGFPGGAGGGGGSGGGG 127

  Fly   191 GGGSGAVLGGGAV---GGSANGYYGGYGGGYGTANG-SVGSTHSQGHSPHSQMMDLPLQCSST-- 249
            |||||   |.|.|   ||.|||.:.|.....|.|.. |..||.|...|..|...   .:||:.  
  Rat   128 GGGSG---GPGPVPSPGGPANGRHYGIKPETGAAPAPSAASTSSSTSSSSSSKR---TECSAARE 186

  Fly   250 -------EPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRL-----------RCDDMGSEN 296
                   |.|.|:.|        .:|....|..|......:|:..           .|.|..|..
  Rat   187 SQGSGGPEFPCNSFL--------RDKAAAAAAAAAGNGPGVGIGTGPGTGGSSEPSACSDHPSPG 243

  Fly   297 DDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQ 361
            ..:.||::........:|..|:                          |....||....      
  Rat   244 CPLKEEEKQPPQPPQQQLDPNN--------------------------PAANWIHARST------ 276

  Fly   362 PGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK 426
                 :::|..||::|.|||||||.:|.||||.||.|:|..|.|:|||:||||||||||.||.:|
  Rat   277 -----RKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSK 336

  Fly   427  426
              Rat   337  336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
Hoxd9NP_001166940.1 Hox9_act 1..>155 CDD:282473 31/94 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..196 30/88 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..267 8/72 (11%)
HOX 276..328 CDD:197696 31/62 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.