DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxa6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:124 Identity:66/124 - (53%)
Similarity:84/124 - (67%) Gaps:13/124 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 SPDELGSNDNDDDLGDSDSDEDLMAETTDGERI--IYPWMKKIH-VAGVANGSYQPGMEPKRQRT 371
            ||::....|:....|.:     |..|.||.:..  :||||:::: .||...||:     .:|.|.
  Rat   106 SPEQQYKPDSSSVQGKA-----LHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSH-----GRRGRQ 160

  Fly   372 AYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNT 430
            .|||:|.||||||||:|||||||||||||:.|.|:|||||||||||||||||:|||.|:
  Rat   161 TYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 42/51 (82%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.