DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Isx

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_008770554.1 Gene:Isx / 682968 RGDID:1592776 Length:242 Species:Rattus norvegicus


Alignment Length:218 Identity:53/218 - (24%)
Similarity:84/218 - (38%) Gaps:63/218 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 GLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSD 327
            |..:::.||::....:..::||:....:              .:|.| |.|..:......:|..|
  Rat     3 GPTIQRDIEKSSGYCEAPEKLGLSFSIE--------------AILKR-PTERRNLPRPQSIGGGD 52

  Fly   328 SDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPK---RQRTAYTRHQILELEKEFHYNR 389
            |.:    .||.|.::..|...            ||..|.|   |.||.:|..|:.||||.||:..
  Rat    53 SRQ----TTTSGSKLEKPTQD------------QPQEERKNKRRVRTTFTTEQLQELEKLFHFTH 101

  Fly   390 YLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL--------------------------- 427
            |.....|.::|..:.|.|.:::|||||:|.||:|..|.                           
  Rat   102 YPDIHVRSQLASRINLPEARVQIWFQNQRAKWRKQEKSGSLSAPQQPGSCTDAHCSAHIGATHRM 166

  Fly   428 --PNTKNVRKKTVDANGNPTPVA 448
              |.:.:.|.|.|....:|.|:|
  Rat   167 LPPLSDSARFKLVPCPDSPCPMA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
IsxXP_008770554.1 Homeobox 82..134 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.