DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Nkx3-2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_008768461.2 Gene:Nkx3-2 / 682329 RGDID:1584617 Length:328 Species:Rattus norvegicus


Alignment Length:320 Identity:80/320 - (25%)
Similarity:122/320 - (38%) Gaps:93/320 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 TSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSST 249
            |..|..||...::|...|...:|.|:.....||:.:     .|..|:.:....:..|:|  .:|.
  Rat    58 TEAGALGGAEDSLLASPARTRTAVGHSAESPGGWDS-----DSALSEENEGRRRCADVP--GASG 115

  Fly   250 EPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDEL 314
            .......|||::...|                                |:.||.|:   ||..|:
  Rat   116 TGHARVTLGLEQHAAK--------------------------------DLEEEARI---RSDSEM 145

  Fly   315 GSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGM--------EP----- 366
            .::.:.|   .|...|| .:.:..|.|:  |.:     .|.|.|....|.        ||     
  Rat   146 SASVSGD---HSPRGED-GSVSPGGARV--PGL-----CGTAGGGASSGQAGGVEEEEEPAAPKP 199

  Fly   367 --KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPN 429
              ||.|.|::..|:.|||:.|::.|||:...|.::|.:|.|:|.|:||||||||.|.|:      
  Rat   200 RKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKR------ 258

  Fly   430 TKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSL 489
                |:...|...: .|.|||...:...:..|:            |..|  .|.:|..||
  Rat   259 ----RQMAADLLAS-APAAKKVAVKVLVRDDQR------------QYLP--GEVLRPPSL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
Nkx3-2XP_008768461.2 Homeobox 204..258 CDD:395001 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.