DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Nkx1-1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_035450.1 Gene:Nkx1-1 / 672284 MGIID:109346 Length:440 Species:Mus musculus


Alignment Length:295 Identity:79/295 - (26%)
Similarity:106/295 - (35%) Gaps:57/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 AGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYY-------GGYGGGYG--- 219
            |..|.....:|..|.|.:...:.   ...:|.....||...||...|       .||..|.|   
Mouse   118 AACVAVPAASGRSPRAELERRAL---SAATGVAAAAGAEPTSAGDSYRADEAEANGYSSGSGRSP 179

  Fly   220 TANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIE-EAVPAGQQLQEL 283
            ||:....:...:......::.|    ...||.|...:.||...|.......| ||.|.       
Mouse   180 TADSEDEAPEDEDEEEAPEVQD----AQGTEEPRGGSGGLGARGSGCPGAAEVEASPV------- 233

  Fly   284 GMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMK 348
                  ||..:...         ...||...|........|.:.|.....|.||..:|      |
Mouse   234 ------DDTAAPGP---------RGNSPGAPGPPATATGAGSAGSTPQGAAVTTKPKR------K 277

  Fly   349 KIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIW 413
            :       .||.....:|:|.|||:|..|::.||.:|...|||:...|:.:|.:|.|:|.|:|||
Mouse   278 R-------TGSDSKSGKPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVKIW 335

  Fly   414 FQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVA 448
            |||||.||||.|...:|    .......|.|.|.|
Mouse   336 FQNRRTKWKKQNPGADT----SAPTGGGGGPGPGA 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)
Nkx1-1NP_035450.1 Homeobox 292..344 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.