DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Nkx6-1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_113925.1 Gene:Nkx6-1 / 65193 RGDID:69318 Length:365 Species:Rattus norvegicus


Alignment Length:381 Identity:77/381 - (20%)
Similarity:129/381 - (33%) Gaps:134/381 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SAGGYSSNYANATPPSHPHS-----HPHAHPHQSLGYYVHHAPEFISAGAVH------SDPTNGY 176
            |:...||:.::.:||...|:     .|.|....|||    ..|:.:||...|      |.|:...
  Rat    49 SSSSSSSSSSSPSPPLGAHNPGGLKPPAAGGLSSLG----SPPQQLSAATPHGINDILSRPSMPV 109

  Fly   177 GPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMD 241
            ...|.:|:.|..|....|.:  ...|...||            .|..:..:..:...||...:..
  Rat   110 ASGAALPSASPSGSSSSSSS--SASATSASA------------AAAAAAAAAAAAASSPAGLLAG 160

  Fly   242 LPLQCSSTEPP-------TNTALGLQELGLKLEKRIEEAVPAGQQLQELGM---------RLRCD 290
            ||...|.:.||       :.:|..:..:| :..|.:.| :|....:...|:         ||.| 
  Rat   161 LPRFSSLSPPPPPPGLYFSPSAAAVAAVG-RYPKPLAE-LPGRTPIFWPGVMQSPPWRDARLAC- 222

  Fly   291 DMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGV 355
                    ...:..::||:                            ||:|              
  Rat   223 --------TPHQGSILLDK----------------------------DGKR-------------- 237

  Fly   356 ANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMK 420
                       |..|..::..||..|||.|...:||....|..:|::|.::|.|:|:||||||.|
  Rat   238 -----------KHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTK 291

  Fly   421 WKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQ 476
            |:|                         |...:.|.:||:|.::.::.....:.::
  Rat   292 WRK-------------------------KHAAEMATAKKKQDSETERLKGTSENEE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
Nkx6-1NP_113925.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..136 23/92 (25%)
Repressor domain. /evidence=ECO:0000250 102..269 43/244 (18%)
Homeobox 240..294 CDD:395001 23/53 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..365 5/28 (18%)
Involved in DNA-binding. /evidence=ECO:0000250 307..365 1/16 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.