DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Vax2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_072159.1 Gene:Vax2 / 64572 RGDID:621133 Length:292 Species:Rattus norvegicus


Alignment Length:298 Identity:75/298 - (25%)
Similarity:105/298 - (35%) Gaps:98/298 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 KRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLD---RSPDEL--------------- 314
            ||.||  |.|:.             |...:....|| |..|   .||.|:               
  Rat    13 KRREE--PGGRS-------------GCRGEHRGAED-LRADTGSTSPREIAGTSASSPAGSRESG 61

  Fly   315 GSNDNDDDLGDSDSDEDLMAETTDG--ERIIYPWMKKIHVAGVANGSYQPGME---PKRQRTAYT 374
            |.:|....||::|....::.....|  ..|:.|                .|::   |||.||::|
  Rat    62 GDSDGQQALGETDHCRRILVRDAKGTIREIVLP----------------KGLDLDRPKRTRTSFT 110

  Fly   375 RHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVD 439
            ..|:..||.||...:|:..|.|.|:|..|.|||.|:|:||||||.|.|||......|.......:
  Rat   111 AEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSAFE 175

  Fly   440 A-----------NGNPTPVAKKPTKRA---------ASKKQQQAQQQQQSQQQQTQQTPVMNECI 484
            |           .|....|.:.|:..|         |..:.......:.|.|:            
  Rat   176 AFATSNVLRLLEQGRLLSVPRAPSLLALSPGLPGLTAGHRGTSLGDPRNSSQR------------ 228

  Fly   485 RSDSLESIGDVSSSLGNPPYIP-----AAP--ETTSSY 515
                |..:...|:|...||.:|     |||  :..:||
  Rat   229 ----LNPMPSASASSPLPPPLPAVCFSAAPLLDLPASY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)
Vax2NP_072159.1 vax upstream domain 74..101 5/42 (12%)
homeobox 102..161 31/58 (53%)
Homeobox 105..158 CDD:278475 26/52 (50%)
vax downstream domain 182..193 1/10 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..241 6/44 (14%)
vax terminal domain 266..274
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.