DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxa5a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571615.1 Gene:hoxa5a / 58055 ZFINID:ZDB-GENE-000823-9 Length:227 Species:Danio rerio


Alignment Length:239 Identity:94/239 - (39%)
Similarity:124/239 - (51%) Gaps:52/239 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 GGYGGGYGTANGSVGSTHSQGH-------------SPHSQMM--DLPLQCSSTEPPTN----TAL 257
            |.|..||...:.|.|.: |.||             ||.:..:  :.|:..||.||.::    ::|
Zfish     4 GRYACGYNGMDLSTGHS-SPGHFLSSGERTQSYKDSPTATPVRYNQPVTASSAEPSSDHLPCSSL 67

  Fly   258 GLQELGLKLEK--RIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDND 320
            ....:..:..:  :|..:..||...:..|..|..:.:...:..|.||      :.|         
Zfish    68 ANSPVSEQSHRALKISLSSTAGSASKSFGTVLSREGVSKVSSSMEEE------KPP--------- 117

  Fly   321 DDLGDSDSDEDLMAETTDGERIIYPWMKKIHVA--GVANGSYQPGMEPKRQRTAYTRHQILELEK 383
               |...:....::|...    |||||:|:|::  .:|      |.|.||.||||||:|.|||||
Zfish   118 ---GSGQTASQNVSEAPQ----IYPWMRKLHISHDNLA------GPEGKRPRTAYTRYQTLELEK 169

  Fly   384 EFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL 427
            |||:||||||||||||||||.|||||||||||||||||||||||
Zfish   170 EFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDNKL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 47/51 (92%)
hoxa5aNP_571615.1 Homeobox 155..208 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.