DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb6b

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b / 58053 ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio


Alignment Length:313 Identity:99/313 - (31%)
Similarity:130/313 - (41%) Gaps:107/313 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SSNYANAT-PPSHP---HSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPN---T 185
            ||.:.|:| |.|.|   .|.....|..|.||          ..::...|:..:| |.||.:   |
Zfish     2 SSYFVNSTFPVSLPGGQESFLGQIPLYSSGY----------TDSLRHYPSATFG-ATNVQDKVYT 55

  Fly   186 SNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTE 250
            |:                      ||...||.:|.:    |||.:..:|..:........|    
Zfish    56 SS----------------------YYQQAGGVFGRS----GSTSACDYSTPNIYRSADRSC---- 90

  Fly   251 PPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELG 315
                 |:|..|..|.|.:.              ..:..|.:.|:|. ..|.||:   ..:|    
Zfish    91 -----AIGSLEDSLVLTQD--------------QCKTDCTEQGTER-YFSTEDK---PCTP---- 128

  Fly   316 SNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILE 380
                                       :||||::::   ..||  .||...:|.|..|||.|.||
Zfish   129 ---------------------------VYPWMQRMN---SCNG--MPGSTGRRGRQTYTRFQTLE 161

  Fly   381 LEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNV 433
            ||||||:||||||||||||:|.|.|:|||||||||||||||||:||..|:..|
Zfish   162 LEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKENKAVNSAKV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 42/51 (82%)
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134 3/4 (75%)
Homeobox 151..203 CDD:278475 42/51 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.