DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxc1a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_571606.1 Gene:hoxc1a / 58046 ZFINID:ZDB-GENE-000822-2 Length:302 Species:Danio rerio


Alignment Length:324 Identity:87/324 - (26%)
Similarity:127/324 - (39%) Gaps:107/324 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LPHHHSNSAISGHHQASAGGYSSNYANATPPSHPHS---HPHAHPHQSLGYYVHHAPEFISAGAV 168
            |.:|.:|...:.....|........||:|.|..|.:   :...||::.      ..|.|.|. ..
Zfish    49 LQYHFTNLCATATGACSKPCEDPGRANSTRPPFPQNQDFYRPVHPNRP------QVPSFQSC-RE 106

  Fly   169 HSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTAN---GSVGSTHS 230
            ......|:.|:::...|                                :.:|:   |.|.:|.:
Zfish   107 QGLSRKGFSPSSDTFRT--------------------------------FSSAHCELGPVNNTQT 139

  Fly   231 QGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSE 295
            :     .:..|.|::.|:.| ..||..|..       ..:.|.:.:|:..:  .||:|       
Zfish   140 E-----VRTYDGPVRHSAVE-DDNTGHGAL-------NTLNETLHSGKTFE--WMRVR------- 182

  Fly   296 NDDMSEEDRLMLDRSPD-ELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGS 359
             .:.|...::.|.:..| ||.:|..      .|||||    |:.|                  ||
Zfish   183 -RNQSRAAKIQLGKCSDRELKTNHG------RDSDED----TSSG------------------GS 218

  Fly   360 YQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
                      ||.:|..|:.|||||||:|:||||.||||||:.|.|||.|:||||||||||.||
Zfish   219 ----------RTNFTTKQLTELEKEFHFNKYLTRARRIEIANPLQLSETQVKIWFQNRRMKQKK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 37/51 (73%)
hoxc1aNP_571606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..224 15/63 (24%)
Homeobox 218..271 CDD:278475 38/62 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.