DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb7a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001108563.1 Gene:hoxb7a / 58044 ZFINID:ZDB-GENE-000329-2 Length:227 Species:Danio rerio


Alignment Length:280 Identity:90/280 - (32%)
Similarity:111/280 - (39%) Gaps:114/280 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PEFIS-AGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANG 223
            ||..| |.:..|...:|||.|      |.|.....|.:|        |....|         .||
Zfish    27 PEQTSCAFSCSSQRASGYGSA------STGAPVSSSSSV--------SLPSMY---------TNG 68

  Fly   224 SVGSTHSQGHSP------------HSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPA 276
            :..|:|:||..|            ||.:.|.|          |..:                |.|
Zfish    69 TSLSSHTQGMYPTAYELGAVSLNMHSSLFDHP----------NLPM----------------VSA 107

  Fly   277 GQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGER 341
            |             |:........||.|          |.:.|:::                 ..
Zfish   108 G-------------DLCKAQSSGKEEQR----------GYHQNNEN-----------------NL 132

  Fly   342 IIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLS 406
            .|||||:            ..|.:.||.|..|:|:|.||||||||:||||:|||||||||.|.|:
Zfish   133 RIYPWMR------------STGADRKRGRQTYSRYQTLELEKEFHFNRYLSRRRRIEIAHALCLT 185

  Fly   407 ERQIKIWFQNRRMKWKKDNK 426
            |||||||||||||||||:||
Zfish   186 ERQIKIWFQNRRMKWKKENK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 41/51 (80%)
hoxb7aNP_001108563.1 Antp-type hexapeptide 134..139 4/4 (100%)
Homeobox 149..201 CDD:278475 41/51 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..227 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.