DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and CG34367

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:349 Identity:72/349 - (20%)
Similarity:120/349 - (34%) Gaps:88/349 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 TANGSVGSTHSQG-HSPHSQMMDLPLQCSST----EP-PTNTALGLQE-------LGLKLEKRIE 271
            ::.||...|.:.| .|....:.||.:..|:|    :| ||..:...:|       |...|.|...
  Fly    49 SSGGSYADTCASGEESVDIDITDLSVSESNTILAIDPEPTEESHSQREEHVETYSLSPTLHKAAV 113

  Fly   272 EAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAET 336
            |..|....:.|        |:   :.|...||..|.......:.....|.:......|:.|:.|.
  Fly   114 EPKPKNWLISE--------DL---DVDSQPEDPKMSGLPTASITECTEDSNTPKLAPDKPLLPEE 167

  Fly   337 TDGERIIYPWMKKIHV----AGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRI 397
            .....   |...:.|.    ..:.|      .:.:|.||.:|..|:.|||:.|....|.....|.
  Fly   168 CVSPE---PSRNREHCDPLDTSLVN------TKQRRSRTNFTLDQLNELERLFEETHYPDAFMRE 223

  Fly   398 EIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQ 462
            |::..|.|||.::::||||||.|.:|.      :|...|.........|:|              
  Fly   224 ELSQRLGLSEARVQVWFQNRRAKCRKH------ENQMHKGFLVGSRSPPIA-------------- 268

  Fly   463 AQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYPGSQQHLSNNNN 527
                          || :..|..:                ||:..|...:||.|......:::|.
  Fly   269 --------------TP-LEPCRVA----------------PYVSLAALRSSSVPSHPAAATSSNP 302

  Fly   528 NGSGNNNNNNNNNNSNLNNNNNNN 551
            ...|.:..:::.....:::.:|:|
  Fly   303 QAPGVSGTSSSGKVVTVDSPHNHN 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
CG34367NP_001097140.1 Homeobox 195..248 CDD:278475 22/52 (42%)
OAR 392..409 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.