Sequence 1: | NP_477201.1 | Gene: | Dfd / 40832 | FlyBaseID: | FBgn0000439 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025440.1 | Gene: | msx2a / 573620 | ZFINID: | ZDB-GENE-980526-322 | Length: | 257 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 50/195 - (25%) |
---|---|---|---|
Similarity: | 81/195 - (41%) | Gaps: | 53/195 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 313 ELGSNDNDDDLGDSD--------------SDEDLMAETTDG-----------ERIIY-------- 344
Fly 345 ---------PWMKKIHVAGVANGSYQPGMEPKRQ-------RTAYTRHQILELEKEFHYNRYLTR 393
Fly 394 RRRIEIAHTLVLSERQIKIWFQNRRMKWKK--DNKLPNTKNVRKKTVDANGN-PTPVAKKPTKRA 455
Fly 456 455 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dfd | NP_477201.1 | Homeobox | 370..422 | CDD:278475 | 25/51 (49%) |
msx2a | NP_001025440.1 | Homeobox | 125..178 | CDD:278475 | 25/52 (48%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |