DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and bsx

DIOPT Version :10

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_999892.1 Gene:bsx / 573364 ZFINID:ZDB-GENE-040628-4 Length:227 Species:Danio rerio


Alignment Length:104 Identity:39/104 - (37%)
Similarity:51/104 - (49%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 PGMEPKRQ--RTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK- 423
            ||...:|:  ||.::..|:..|||.|...|||:...|:|:|..|.|||.|:|.||||||||.|| 
Zfish    99 PGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQ 163

  Fly   424 ------DNKLPN----------TKNVRKKTVDANGNPTP 446
                  |.|.||          ...:.:|..|.....:|
Zfish   164 LRKTQDDQKTPNDVDRSLENTSESEMHEKNTDGKNGMSP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeodomain 367..423 CDD:459649 28/57 (49%)
bsxNP_999892.1 Homeodomain 106..162 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..227 12/46 (26%)

Return to query results.
Submit another query.