DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and meox2b

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001038589.1 Gene:meox2b / 566969 ZFINID:ZDB-GENE-060503-853 Length:289 Species:Danio rerio


Alignment Length:364 Identity:91/364 - (25%)
Similarity:123/364 - (33%) Gaps:152/364 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NPHSHSHS-H------THSLPHHHSNSAISG-HHQASAGGYSSNYANATPPSHP-HSHPHAHPHQ 150
            |||:.|.: |      .|....|.|...:.| ....|..|..|::..|....|| ..||| ||. 
Zfish    11 NPHAPSQALHPAFTQALHGRSDHISYPDLPGPSPPCSYAGEESSFGGAHHRVHPAPQHPH-HPQ- 73

  Fly   151 SLGYYVHHAPEFISAGAVHSDPTNGYG-----PAANVPNTSNGGGGGGSGAVLGGGAVGGSANGY 210
               ::..|.|:..|   :.|:   .:|     |.|..|... |.|.|..|...|...:.||....
Zfish    74 ---HHQWHVPQMPS---IESE---RHGLCLPHPDAAAPELC-GTGAGSQGMCAGNPTLTGSDPSG 128

  Fly   211 YGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVP 275
            .....|.||..|                       .|..||               |:|..:   
Zfish   129 VSCVPGEYGRQN-----------------------MSPVEP---------------ERRSSK--- 152

  Fly   276 AGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGE 340
                                                            |.|||.:.         
Zfish   153 ------------------------------------------------GKSDSSDS--------- 160

  Fly   341 RIIYPWMKKIHVAGVANGSYQPGM--EPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTL 403
                           .:|||:..:  :|:::|||:|:.||.|||.||.::.||||.||.|||..|
Zfish   161 ---------------QDGSYKSDVSSKPRKERTAFTKEQIRELESEFAHHNYLTRLRRYEIAVNL 210

  Fly   404 VLSERQIKIWFQNRRMKWK-----------KDNKLPNTK 431
            .|:|||:|:||||||||||           ::.:|.|.|
Zfish   211 DLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
meox2bNP_001038589.1 Homeobox 177..229 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.